PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA08G20810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 276aa    MW: 28856.9 Da    PI: 7.2096
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA08G20810.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.51.3e-3759117462
           zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                      +  +cprC+s++tkfCyynny++sqPr+fCk CrryWtkGG+lrnvPvGgg+rk+ +ss
  ONIVA08G20810.1  59 EGDPCPRCESRDTKFCYYNNYNTSQPRHFCKCCRRYWTKGGTLRNVPVGGGTRKKSSSS 117
                      5678**************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2660112IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.28661115IPR003851Zinc finger, Dof-type
PfamPF027014.6E-3162115IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106399IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MQEQQPETGR RPAQQFATVD LRRPKGYAAA PATPQPGSAA TAAAAAGPAA TAAAAAAGEG  60
DPCPRCESRD TKFCYYNNYN TSQPRHFCKC CRRYWTKGGT LRNVPVGGGT RKKSSSSSSS  120
SSSSSAAAAA PAAKRQKTSK KRRVTTPEPL AATTPVLTEA AADSAAKTTT EATSEKKTTT  180
STTTTTPPAP DTTSEITTEL VVPAVEEDSF TDLLQPDSAA VTLGLDFSDY PSITKSLADP  240
DLHFEWPPPA FDMASYWPAG AGFADPDPTA VFLNLP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2413640.0AK241364.1 Oryza sativa Japonica Group cDNA, clone: J065152E11, full insert sequence.
GenBankAP0046200.0AP004620.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0605H02.
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650493.10.0PREDICTED: dof zinc finger protein MNB1A
SwissprotP385641e-70MNB1A_MAIZE; Dof zinc finger protein MNB1A
TrEMBLA0A0E0IDM20.0A0A0E0IDM2_ORYNI; Uncharacterized protein
TrEMBLA0A0E0QKJ00.0A0A0E0QKJ0_ORYRU; Uncharacterized protein
TrEMBLQ6ZBQ10.0Q6ZBQ1_ORYSJ; Os08g0490100 protein
STRINGLOC_Os08g38220.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.11e-28DOF zinc finger protein 1